manageditservaysystems.cwakakabetdolip6.tumblr.cclark-standfield-qa.cnenektogel4d.us has indexed query results on various search engines, including Baidu indexed query, Google indexed query, Yahoo indexed query, Live indexed query, Youdao indexed query, Sogou indexed query, 163 indexed query, Soso indexed query, China search indexed query, Altavista indexed query, Alltheweb indexed query, etc. Anti link query results, PR queries, Sogourank queries, Alexa ranking queries on major search engines
manageditservaysystems.cwakakabetdolip6.tumblr.cclark-standfield-qa.cnenektogel4d.us Data query
manageditservaysystems.cwakakabetdolip6.tumblr.cclark-standfield-qa.cnenektogel4d.us Domain name Whois information
Domain Name: US.CC
Registry Domain ID: 87023469_DOMAIN_CC-VRSN
Registrar WHOIS Server: grs-whois.hichina.com
Registrar URL: http://wanwang.aliyun.com
Updated Date: 2024-05-15T14:02:28Z
Creation Date: 2006-04-07T08:02:09Z
Registry Expiry Date: 2025-04-07T08:02:09Z
Registrar: Alibaba Cloud Computing Ltd. d/b/a HiChina (www.net.cn)
Registrar IANA ID: 1599
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +86.95187
Domain Status: ok https://icann.org/epp#ok
Name Server: NS1.22.CN
Name Server: NS2.22.CN
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2024-09-11T15:22:24Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the
expiration date of the domain name registrant's agreement with the
sponsoring registrar. Users may consult the sponsoring registrar's
Whois database to view the registrar's reported date of expiration
for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign's ("VeriSign") Whois
database is provided by VeriSign for information purposes only, and to
assist persons in obtaining information about or related to a domain name
registration record. VeriSign does not guarantee its accuracy.
By submitting a Whois query, you agree to abide by the following terms of
use: You agree that you may use this Data only for lawful purposes and that
under no circumstances will you use this Data to: (1) allow, enable, or
otherwise support the transmission of mass unsolicited, commercial
advertising or solicitations via e-mail, telephone, or facsimile; or
(2) enable high volume, automated, electronic processes that apply to
VeriSign (or its computer systems). The compilation, repackaging,
dissemination or other use of this Data is expressly prohibited without
the prior written consent of VeriSign. You agree not to use electronic
processes that are automated and high-volume to access or query the
Whois database except as reasonably necessary to register domain names
or modify existing registrations. VeriSign reserves the right to restrict
your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.